PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D07G0168
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 292aa    MW: 32757.1 Da    PI: 9.2532
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D07G0168genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.26e-161461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+ Ed+ll+ ++k +G g W+  +r+ g++R++k+c++rw++yl
      Gh_D07G0168 14 KGAWTALEDKLLASYIKAHGEGKWSDLSRRAGLKRCGKSCRLRWLNYL 61
                     79********************************************97 PP

2Myb_DNA-binding48.91.5e-1567113148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg+ + +E+el+++++++lG++ W++Ia +++ gRt++++k++w+++l
      Gh_D07G0168  67 RGNISRDEEELIIRLHNLLGNRLWSLIAGRLP-GRTDNEIKNYWNTVL 113
                      788999**************************.************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.734961IPR017930Myb domain
SuperFamilySSF466891.8E-2612109IPR009057Homeodomain-like
SMARTSM007177.2E-131363IPR001005SANT/Myb domain
PfamPF002491.8E-141461IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.8E-221568IPR009057Homeodomain-like
CDDcd001672.64E-91661No hitNo description
PROSITE profilePS5129423.02462117IPR017930Myb domain
SMARTSM007172.0E-1466115IPR001005SANT/Myb domain
PfamPF002495.6E-1467113IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.4E-2269116IPR009057Homeodomain-like
CDDcd001676.81E-1271113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 292 aa     Download sequence    Send to blast
MGRSPSCPKE GLNKGAWTAL EDKLLASYIK AHGEGKWSDL SRRAGLKRCG KSCRLRWLNY  60
LRPDIKRGNI SRDEEELIIR LHNLLGNRLW SLIAGRLPGR TDNEIKNYWN TVLRKRAKGQ  120
ASIGTPPSKS THKMLSTESG DCEPLRSPRA TKAKIKVILT KATRSSSKVR IPTQLPAAQH  180
TDKLRDGQLN STNNNQEMSG NIATVEAHNG TQVLDSLYSD GGGTDLLNEQ LKERDVEFEE  240
NPMQPLAFDE AMFKNWTVNP CLNGNDAMDF DSLALLLETD EFSFCRNINF QT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C3e-251211725128MYB TRANSFORMING PROTEIN
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1098886201e-166
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF3362841e-116AF336284.1 Gossypium hirsutum GHMYB36 (ghmyb36) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012487959.10.0PREDICTED: myb-related protein 308-like
SwissprotP102901e-59MYBC_MAIZE; Anthocyanin regulatory C1 protein
TrEMBLA0A0D2PKN40.0A0A0D2PKN4_G
STRINGPOPTR_0006s23840.12e-81(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM2438634
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38620.15e-58myb domain protein 4